PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G07880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 367aa    MW: 39286.6 Da    PI: 6.3986
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G07880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd  l+ +v  +G+g +W + ++++g++R++k+c++rw++yl
  LPERR09G07880.1 14 KGPWAPEEDAALKAYVDAHGTGgNWIALPHKIGLNRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.71.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T++Ed l+  +    G++ W+tIa+ ++ gRt++++k++w++
  LPERR09G07880.1  69 GGFTEDEDRLICSLYIAIGSR-WATIAAQLP-GRTDNDIKNYWNS 111
                      569******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.757962IPR017930Myb domain
SuperFamilySSF466898.13E-2612109IPR009057Homeodomain-like
SMARTSM007178.1E-111364IPR001005SANT/Myb domain
PfamPF002493.1E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-221569IPR009057Homeodomain-like
CDDcd001671.19E-71662No hitNo description
PROSITE profilePS5129420.43263117IPR017930Myb domain
SMARTSM007176.7E-1167115IPR001005SANT/Myb domain
PfamPF002496.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2270117IPR009057Homeodomain-like
CDDcd001674.64E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWAPE EDAALKAYVD AHGTGGNWIA LPHKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FTEDEDRLIC SLYIAIGSRW ATIAAQLPGR TDNDIKNYWN SKLKRRLLGG  120
GRRPRGAPPR LVLSTAVAAT TSRNALAASA IERMQLSVRL RRLETPAPPP PSFAFYGSAN  180
LAAPPPWPSH HQQQPDLPSP AASGSSLEMP PRRWLPSSSA ATTSYSGLIS SSYHDAWIDT  240
STTSIGDTTP TTTTGGWDSS SSTPTVSTAT TPFVGGGGSM DMEDEIDMLL QQINYSFEEN  300
DDNNGDRRLI ADEVAAGAES YLRALIGEAA AAAANGGDGE GGWSSCSTPG VDSVFHDYGQ  360
LDYGQYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632601e-121BT063260.1 Zea mays full-length cDNA clone ZM_BFc0043P16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610955.11e-171PREDICTED: transcription factor MYB30-like
SwissprotQ9FKL25e-79MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0D9XDZ80.0A0A0D9XDZ8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA029715-PA1e-177(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132652632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-75myb domain protein 36